When our customers succeed, we do too!

Why Choose Us

When our customers succeed, we do too!

Why Choose Us

When our customers succeed, we do too!

Why Choose Us

When our customers succeed, we do too!

Why Choose Us

Enabling the entrepreneur in you to scale higher!

Business Loans for MSMEs: Easy to avail, Flexible to repay!

Tailoring loans that are best suited for your needs!

apply-for-loancustomer-service

When our customers succeed, we do too!

Why Choose Us

Why Choose Us

our-appraoch-logo

OUR APPROACH

We recognize that every customer is unique and so are his finance needs, hence a ‘one-size fit all’ approach does not really serve the purpose. At Karvy Finance we believe in closely engaging with our customers to get a complete understanding of their business and the environment in which they operate and accordingly offer them a tailor-made loan.

our-values-logo

OUR VALUES

At Karvy Finance we are driven by values that are designed keeping our customers at the center. Through our actions and behavior we constantly demonstrate these values and promise to deliver you an unforgettable and rewarding experience. Our core values are – Customer Centricity, Efficiency, Excellence, Trust, and Respect. (Please click here to know more)

karvy-group-logo

KARVY GROUP

By choosing Karvy Finance our customers not only get their loan requirements fulfilled but also get complete access to the entire suite of products offered by our group companies such as trading in equity, investment advisory, commodities broking, insurance advisory and wealth management. The group through its 1300 offices in over 470 cities caters to the complete financial needs of customers and helps to realize your dream of having a future that is financially stable and secured.

Customer Testimonials

PUBLIC NOTICE / CAUTIONARY ADVISORY

(Issued in Public Interest by Karvy Financial Services Limited)

It has come to the attention of Karvy Financial Services Limited (KFSL) that certain unauthorized individuals and/or entities are fraudulently impersonating the Company and misusing its name, logo, and corporate identity to deceive members of the public by offering loans and other financial products.

Fraudulent domains such as www.karvyfinancialserviceslimited.com and the email ID info@karvyfinancialserviceslimited.com are being used to mislead and defraud unsuspecting individuals. Additionally, fake social media accounts have been created on platforms like Instagram and Facebook, including:

Further, fraudulent mobile numbers such as +91-97792 86670 and +91-9878560762 are being used for such impersonation attempts.

Members of the public are strictly cautioned that KFSL has no association or affiliation whatsoever with any such persons, companies, digital platforms & phone numbers making these false representations. Any person dealing with such impersonators shall be doing so entirely at their own risk, cost, and consequences, and KFSL shall not be liable for any loss, damage, or fraud arising therefrom.

Such fraudulent acts constitute serious criminal offences under the Bhartiya Nyay Sanhita, 2023 and the Information Technology Act, 2000. KFSL has initiated and shall continue to pursue legal and criminal proceedings against those responsible for these unlawful activities.

Members of the public are advised to verify the authenticity of any communication or offer claiming to be from Karvy Financial Services Limited (KFSL) and rely only on the company’s official website/domain – www.karvyfinance.com (erstwhile domain name: www.karvy.com) or authorized representatives. Any suspicious activity should be reported immediately to the nearest police station or cybercrime authorities and also brought to the attention of KFSL’s authorized representative:

Mr. Dattaprasad Naik
Ph: +91-97694-54560
E: dattaprasad.naik@karvyfinance.com

Stay vigilant. Do not share personal or banking information, transfer funds, or click on links from unknown sources impersonating Karvy Financial Services Limited (KFSL).

Issued by:
KARVY FINANCIAL SERVICES LIMITED
(An NBFC registered with the Reserve Bank of India)
Registered Office: 301, Gujrals House, 167, Cst Road, Opp
IDBI Bank, Kolivery Area Village, MMRDA, Kalina, Santacruz (East),
Mumbai– 400098

Powered by